- Database
- Open Access
- Published:
TCM-Blast for traditional Chinese medicine genome alignment with integrated resources
BMC Plant Biology volume 21, Article number: 339 (2021)
Abstract
The traditional Chinese medicine (TCM) genome project aims to reveal the genetic information and regulatory network of herbal medicines, and to clarify their molecular mechanisms in the prevention and treatment of human diseases. Moreover, the TCM genome could provide the basis for the discovery of the functional genes of active ingredients in TCM, and for the breeding and improvement of TCM. The traditional Chinese Medicine Basic Local Alignment Search Tool (TCM-Blast) is a web interface for TCM protein and DNA sequence similarity searches. It contains approximately 40G of genome data on TCMs, including protein and DNA sequence for 36 TCMs with high medical value.The development of a publicly accessible TCM genome alignment database hosted on the TCM-Blast website (http://viroblast.pungentdb.org.cn/TCM-Blast/viroblast.php) has expanded to query multiple sequence databases to obtain TCM genome data, and provide user-friendly output for easy analysis and browsing of BLAST results. The genome sequencing of TCMs helps to elucidate the biosynthetic pathways of important secondary metabolites and provides an essential resource for gene discovery studies and molecular breeding. The TCMs genome provides a valuable resource for the investigation of novel bioactive compounds and drugs from these TCMs under the guidance of TCM clinical practice. Our database could be expanded to other TCMs after the determination of their genome data.
Background
Whole-genome sequencing of the plants that form the basis of traditional Chinese medicine (TCM) is an important means for gene discovery and cultivation, synthetic biology, drug discovery and molecular breeding involving TCMs [1,2,3,4]. The genomic sequence provides a valuable resource not only for fundamental and applied research, but also for evolutionary and comparative genomics analyses, particularly in TCMs [5,6,7,8,9].
Experimental and clinical studies have demonstrated that TCMs have a wide range of pharmacological properties such as anti-inflammatory, antiviral, antimicrobial, antioxidative, antifungal, antithrombotic, antihyperlipidemic, analgesic, antidiabetic, antidepressant, antiasthma and anticancer activities as well as immunomodulatory, antidiabetic, gastroprotective, hepatoprotective, neuroprotective and cardioprotective effects [10,11,12,13,14,15,16,17,18]. Genome sequencing and its annotations provide an essential resource for TCM improvement through molecular breeding [19,20,21] and for the discovery of useful genes for engineering bioactive compounds through synthetic biology approaches [1, 22,23,24]. The availability of these genomic resources will facilitate the discovery of medicinally and nutritionally important genes, the genetic improvement of TCMs [7, 21, 25] and the identification of novel drug candidates [26].
The Herbal Medicine Omics Database (http://herbalplant.ynau.edu.cn/html/Genomes/) has collected only 23 published genomes of medicinal herbs and there has been no continued update of the increased data since 2019. Only 14 kinds of medicinal plant genome data were provided in the Medicinal Plant Genomics Resource (http://medicinalplantgenomics.msu.edu). BLAST against plant genomes data (https://blast.ncbi.nlm.nih.gov/Blast.cgi?PROGRAM=blastn&_TYPE=BlastSearch&BLAST_SPEC=Plants_MV&LINK_LOC=blasttab&LAST_PAGE=blastp) included few types of medicinal plants, and the genome comparison of the most common edible plants was provided).
Construction and content
Genome data of TCMs were originated from the Herbal Medicine Omics Database (http://herbalplant.ynau.edu.cn/html/Genomes/), the Medicinal Plant Genomics Resource (http://medicinalplantgenomics.msu.edu), and the BIG Data Center in Beijing Institute of Genomics, Chinese Academy of Sciences (http://bigd.big.ac.cn/gsa/statistics).
The genome data of Chinese medicinal materials originating from unlabeled references are from http://medicinalplantgenomics.msu.edu/, http://bigd.big.ac.cn/gsa/statistics.
The deployment strategy for TCM-Blast involves instantiating a provided Viroblast [27] that bundles the core components for TCM genome alignment. A user-friendly web interface to search the database has been implemented in PHP 7.0.32 (http://www.php.net) and deployed on an Apache 2.4.18 web server (http://www.apache.org/) and MySQL database server (https://www.mysql.com/) with Ubuntu 16.04 server (http://mirrors.aliyun.com/ubuntu-releases/16.04/). TCM-Blast had 36 TCMs genome datasets.
The information regarding TCM genome datasets is summarized in an online at the TCM-Blast website. The TCM genome data used in TCM-Blast were collected from the Herbal Medicine Omics Database (http://herbalplant.ynau.edu.cn/html/Genomes/), the Medicinal Plant Genomics Resource (http://medicinalplantgenomics.msu.edu), and the BIG Data Center in Beijing Institute of Genomics (http://bigd.big.ac.cn/gsa/statistics) (the further details on the genome data sources for the thirty-six TCMs, see Table 1). These data resources have been published in professional journals and plant gene databases by academic institutions or government departments merged with plant gene databases, with abundant data sources and reliable data quality. In addition to other data resources, this database in our study has the following advantages: 1) this database is currently the largest Chinese medicine genome database; 2) this database includes the plant genetic data of Chinese medicine sources; and 3) this database provides support for the TCM breeding, cultivation of TCMs and the discovery of active ingredients in TCMs.
Utility and discussion
Overview of TCM-Blast
We have developed TCM-Blast, a web-based database for TCM genome alignment (Fig. 1). TCM-Blast offers an interface to choose from TCM genome databases including TCM protein and DNA sequence datasets, which provide query functions with BLAST implementation [40]. TCM-Blast currently contains approximately 40 GB of TCM genome data, including the proteins and DNA sequences of 36 TCMs.
The mains functions of TCM-Blast
The user can directly enter the query sequence directly by pasting into the query box or by uploading the sequence as a FASTA file from a local file. TCM-Blast provides multiple TCM sequence databases. Users can then select specific TCM genome databases to run different programs (blastn, blastp, blastx, tblastn, tblastx). TCM-Blast consists of five general BLAST form types [27, 41,42,43] for TCM genome data:
-
blastn: search TCM nucleotide databases using a nucleotide query.
-
blastp: search TCM protein databases using a protein query.
-
blastx: search TCM protein databases using a translated nucleotide query
-
tblastn: search TCM translated nucleotide databases using a protein query.
-
tblastx: search TCM translated nucleotide databases using a translated nucleotide query
TCM-Blast provides an optional search function for advanced users who need to collect more specific information (Fig. 2) with the ability to set different parameters, such as the expected threshold, word size, max target sequences, etc., to glean more specific information for users. The TCM-Blast sequence alignment results of the TCM genome sequence are displayed in the summary table, which contains the query sequence name, subject sequence name, subject source database, position score, identity percentage, and E value (Fig. 3).
A case study of this database
For example, the user can select the Salvia Miltiorrhiza protein database with the programs blastp and obtain their expected BLAST results by inputting the protein sequence. In Fig. 4, the user has input the protein sequence fragment:
The BLAST result of Salvia Miltiorrhiza protein alignment with the input of Salvia Miltiorrhiza protein sequence fragment into TCM-Blast. In the first section (a), the user checks their protein sequence. In the second section (b), the BLAST results with the input protein sequence are briefly displayed in the table. Furthermore, detailed score information on this alignment can be checked by clicking each score item button
“MEKKQEDEKKTKLQGLPVDTSPYTQYKDLDDYKKQAYGTEGHLQPNPGRGAAASTDAPTTTAADDPNKQLSSTDAINRQGVP” in the “Enter query sequences” box; selected the Salvia Miltiorrhiza protein database; and obtained the BLAST result by clicking the “Basic Search” button. The top score of this search was “evm.model.C153610.1” subject, indicating that the input sequence fragment has high similarity to the Salvia Miltiorrhiza protein. For more detailed use cases for this database, please refer to the Supplementary file.
In the future, we will collect more Chinese medicine genome data to provide data support for Chinese medicine research.
Conclusions
Here, we reported a database of TCM-Blast database that integrates several database resources and markedly improves the efficiency of TCM genomic research. This database will allow users to perform batch sequence searches against integrated TCM genomic sequence databases. Therefore, TCM-Blast provided comprehensive Chinese medicine genome resource data on TCM scientific research and eliminates the latent redundancy occurring in other platforms.
Availability of data and materials
TCM-Blast is a free database and visualization tool open to all users with no login requirements and can be accessed at the following URL: http://viroblast.pungentdb.org.cn/TCM-Blast/viroblast.php. The web tool is functional on all modern web browsing environments including Google Chrome, Mozilla Firefox and Safari. All related species genomes data can be downloaded from http://viroblast.pungentdb.org.cn/TCM-Blast/db.
Abbreviations
- TCM:
-
Traditional Chinese medicine
- DNA:
-
Deoxyribonucleic acid
- TCM-Blast:
-
Traditional Chinese medicine Basic Local Alignment Search Tool
References
- 1.
Mochida K, Sakurai T, Seki H, Yoshida T, Takahagi K, Sawai S, et al. Draft genome assembly and annotation of Glycyrrhiza uralensis, a medicinal legume. Plant J. 2017;89(2):181–94. https://doi.org/10.1111/tpj.13385.
- 2.
Rehman F, Gong H, Li Z, Zeng S, Yang T, Ai P, et al. Identification of fruit size associated quantitative trait loci featuring SLAF based high-density linkage map of goji berry (Lycium spp.). BMC Plant Biol. 2020;20(1):1–18. https://doi.org/10.1186/s12870-020-02567-1.
- 3.
Chen X, Li J, Wang X, Zhong L, Tang Y, Zhou X, et al. Full-length transcriptome sequencing and methyl jasmonate-induced expression profile analysis of genes related to patchoulol biosynthesis and regulation in Pogostemon cablin. BMC Plant Biol. 2019;19(1):1–18. https://doi.org/10.1186/s12870-019-1884-x.
- 4.
Chen S, Song J, Sun C, Xu J, Zhu Y, Verpoorte R, et al. Herbal genomics: examining the biology of traditional medicines. Science. 2015; 347(6219):S27-S29. https://doi.org/10.17660/ActaHortic.2015.1089.62
- 5.
Guan R, Zhao Y, Zhang H, Fan G, Liu X, Zhou W, et al. Draft genome of the living fossil Ginkgo biloba. Gigascience. 2016;5(1):s13742-016-0154–1. https://doi.org/10.1186/s13742-016-0154-1.
- 6.
Sun H, Wu S, Zhang G, Jiao C, Guo S, Ren Y, et al. Karyotype stability and unbiased fractionation in the paleo-allotetraploid Cucurbita genomes. Mol Plant. 2017;10(10):1293–306. https://doi.org/10.1186/s13742-016-0154-1.
- 7.
Wu P, Zhou C, Cheng S, Wu Z, Lu W, Han J, et al. Integrated genome sequence and linkage map of physic nut (Jatropha curcas L.), a biodiesel plant. Plant J. 2015;81(5):810–21. https://doi.org/10.1111/tpj.12761.
- 8.
Yan L, Wang X, Liu H, Tian Y, Lian J, Yang R, et al. The genome of Dendrobium officinale illuminates the biology of the important traditional Chinese orchid herb. Mol Plant. 2015;8(6):922–34. https://doi.org/10.1016/j.molp.2014.12.011.
- 9.
Liu Y, Zeng S, Sun W, Wu M, Hu W, Shen X, et al. Comparative analysis of carotenoid accumulation in two goji (Lycium barbarum L. and L. ruthenicum Murr.) fruits. BMC Plant Biol. 2014;14(1):1–14. https://doi.org/10.1186/s12870-014-0269-4.
- 10.
Chen Z, Cao Y, Zhang Y, Qiao Y. A novel discovery: holistic efficacy at the special organ level of pungent flavored compounds from pungent traditional Chinese medicine. Int J Mol Sci. 2019;20(3):752. https://doi.org/10.3390/ijms20030752.
- 11.
Cheung F. TCM: made in China. Nature. 2011;480(7378):S82–3. https://doi.org/10.1038/480S82a.
- 12.
Hosseinzadeh H, Nassiri-Asl M. Pharmacological effects of Glycyrrhiza spp. and its bioactive constituents: update and review. Phytother Res. 2015;29(12):1868–86. https://doi.org/10.1002/ptr.5487.
- 13.
Jiang W-Y. Therapeutic wisdom in traditional Chinese medicine: a perspective from modern science. Trends Pharmacol Sci. 2005;26(11):558–63. https://doi.org/10.1016/j.tips.2005.09.006.
- 14.
Qiu J. China plans to modernize traditional medicine. Nature. 2007;446:590–1. https://doi.org/10.1038/446590a.
- 15.
Science AAftAo. The art and science of traditional medicine part 1: TCM today—a case for integration. Science. 2014;346(6216):1569. https://doi.org/10.1126/science.346.6216.1569-d.
- 16.
Xiong X. Integrating traditional Chinese medicine into Western cardiovascular medicine: an evidence-based approach. Nat Rev Cardiol. 2015;12(6):374–374. https://doi.org/10.1038/nrcardio.2014.177-c1.
- 17.
Tian P. Convergence: where west meets east. Nature. 2011;480(7378):S84–6. https://doi.org/10.1038/480S84a.
- 18.
Zhao J, Jiang P, Zhang W. Molecular networks for the study of TCM pharmacology. Brief Bioinform. 2010;11(4):417–30. https://doi.org/10.1093/bib/bbp063.
- 19.
Song C, Liu Y, Song A, Dong G, Zhao H, Sun W, et al. The Chrysanthemum nankingense genome provides insights into the evolution and diversification of chrysanthemum flowers and medicinal traits. Mol Plant. 2018;11(12):1482–91. https://doi.org/10.1016/j.molp.2018.10.003.
- 20.
da Silva JAT, Jin X, Dobránszki J, Lu J, Wang H, Zotz G, et al. Advances in Dendrobium molecular research: applications in genetic variation, identification and breeding. Mol Phylogenet Evol. 2016;95:196–216. https://doi.org/10.1016/j.ympev.2015.10.012.
- 21.
Xu J, Chu Y, Liao B, Xiao S, Yin Q, Bai R, et al. Panax ginseng genome examination for ginsenoside biosynthesis. Gigascience. 2017;6(11):gix093. https://doi.org/10.1093/gigascience/gix093.
- 22.
Vining KJ, Johnson SR, Ahkami A, Lange I, Parrish AN, Trapp SC, et al. Draft genome sequence of Mentha longifolia and development of resources for mint cultivar improvement. Mol Plant. 2017;10(2):323–39. https://doi.org/10.1016/j.molp.2016.10.018.
- 23.
Shen Q, Zhang L, Liao Z, Wang S, Yan T, Shi P, et al. The genome of Artemisia annua provides insight into the evolution of Asteraceae family and artemisinin biosynthesis. Mol Plant. 2018;11(6):776–88. https://doi.org/10.1016/j.molp.2018.03.015.
- 24.
Yang J, Zhang G, Zhang J, Liu H, Chen W, Wang X, et al. Hybrid de novo genome assembly of the Chinese herbal fleabane Erigeron breviscapus. Gigascience. 2017;6(6):gix028. https://doi.org/10.1093/gigascience/gix028.
- 25.
Zhang L, Li X, Ma B, Gao Q, Du H, Han Y, et al. The tartary buckwheat genome provides insights into rutin biosynthesis and abiotic stress tolerance. Mol Plant. 2017;10(9):1224–37. https://doi.org/10.1016/j.molp.2017.08.013.
- 26.
Chen W, Kui L, Zhang G, Zhu S, Zhang J, Wang X, et al. Whole-genome sequencing and analysis of the Chinese herbal plant Panax notoginseng. Mol Plant. 2017;10(6):899–902. https://doi.org/10.1016/j.molp.2017.02.010.
- 27.
Deng W, Nickle DC, Learn GH, Maust B, Mullins JI. ViroBLAST: a stand-alone BLAST web server for flexible queries of multiple databases and user’s datasets. Bioinformatics. 2007;23(17):2334–6. https://doi.org/10.1093/bioinformatics/btm331.
- 28.
Wuyun T-N, Wang L, Liu H, Wang X, Zhang L, Bennetzen JL, et al. The hardy rubber tree genome provides insights into the evolution of polyisoprene biosynthesis. Mol Plant. 2018;11(3):429–42. https://doi.org/10.1016/j.molp.2017.11.014.
- 29.
Qin G, Xu C, Ming R, Tang H, Guyot R, Kramer EM, et al. The pomegranate (Punica granatum L.) genome and the genomics of punicalagin biosynthesis. Plant J. 2017;91(6):1108–28. https://doi.org/10.1111/tpj.13625.
- 30.
Tamiru M, Natsume S, Takagi H, White B, Yaegashi H, Shimizu M, et al. Genome sequencing of the staple food crop white Guinea yam enables the development of a molecular marker for sex determination. BMC Biol. 2017;15(1):1–20. https://doi.org/10.1186/s12915-017-0419-x.
- 31.
Xiao L, Yang G, Zhang L, Yang X, Zhao S, Ji Z, et al. The resurrection genome of Boea hygrometrica: a blueprint for survival of dehydration. Proc Natl Acad Sci. 2015;112(18):5833–7. https://doi.org/10.1073/pnas.1505811112.
- 32.
Tian Y, Zeng Y, Zhang J, Yang C, Yan L, Wang X, et al. High quality reference genome of drumstick tree (Moringa oleifera Lam.), a potential perennial crop. Sci China Life Sci. 2015;58(7):627–38. https://doi.org/10.1007/s11427-015-4872-x.
- 33.
Zhang G, Tian Y, Zhang J, Shu L, Yang S, Wang W, et al. Hybrid de novo genome assembly of the Chinese herbal plant danshen (Salvia miltiorrhiza Bunge). GigaScience. 2015;4(1):s13742-015-0104–3. https://doi.org/10.1186/s13742-015-0104-3.
- 34.
Van Bakel H, Stout JM, Cote AG, Tallon CM, Sharpe AG, Hughes TR, et al. The draft genome and transcriptome of Cannabis sativa. Genome Biol. 2011;12(10):1–18. https://doi.org/10.1186/gb-2011-12-10-r102.
- 35.
Liu X, Liu Y, Huang P, Ma Y, Qing Z, Tang Q, et al. The genome of medicinal plant Macleaya cordata provides new insights into benzylisoquinoline alkaloids metabolism. Mol Plant. 2017;10(7):975–89. https://doi.org/10.1016/j.molp.2017.05.007.
- 36.
Hoopes GM, Hamilton JP, Kim J, Zhao D, Wiegert-Rininger K, Crisovan E, et al. Genome assembly and annotation of the medicinal plant Calotropis gigantea, a producer of anticancer and antimalarial cardenolides. G3: Genes, Genomes, Genetics. 2018;8(2):385–91. https://doi.org/10.1534/g3.117.300331.
- 37.
Fu Y, Li L, Hao S, Guan R, Fan G, Shi C, et al. Draft genome sequence of the Tibetan medicinal herb Rhodiola crenulata. Gigascience. 2017;6(6):gix033. https://doi.org/10.1093/gigascience/gix033.
- 38.
Zhao D, Hamilton JP, Pham GM, Crisovan E, Wiegert-Rininger K, Vaillancourt B, et al. De novo genome assembly of Camptotheca acuminata, a natural source of the anti-cancer compound camptothecin. GigaScience. 2017;6(9):gix065. https://doi.org/10.1093/gigascience/gix065.
- 39.
Kellner F, Kim J, Clavijo BJ, Hamilton JP, Childs KL, Vaillancourt B, et al. Genome-guided investigation of plant natural product biosynthesis. Plant J. 2015;82(4):680–92. https://doi.org/10.1111/tpj.12827.
- 40.
Zhang J, Tian Y, Yan L, Zhang G, Wang X, Zeng Y, et al. Genome of plant maca (Lepidium meyenii) illuminates genomic basis for high-altitude adaptation in the central Andes. Mol Plant. 2016;9(7):1066–77. https://doi.org/10.1016/j.molp.2016.04.016.
- 41.
Jones DT, Swindells MB. Getting the most from PSI–BLAST. Trends Biochem Sci. 2002;27(3):161–4. https://doi.org/10.1016/S0968-0004(01)02039-4.
- 42.
Schäffer AA, Aravind L, Madden TL, Shavirin S, Spouge JL, Wolf YI, et al. Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements. Nucleic Acids Res. 2001;29(14):2994–3005. https://doi.org/10.1093/nar/29.14.2994.
- 43.
Johnson M, Zaretskaya I, Raytselis Y, Merezhuk Y, McGinnis S, Madden TL. NCBI BLAST: a better web interface. Nucleic Acids Res. 2008;36(suppl_2):W5-W9. https://doi.org/10.1093/nar/gkn201
Acknowledgements
We would like to thank Xingde Ren, Xiaosa Shi valuable suggestions. This work was supported by the National Natural Science Foundation of China (No.81430094) and China Postdoctoral Science Foundation (No.2020M670236).
Funding
Funding for open access charge: National Natural Science Foundation of China (No.81430094) and China Postdoctoral Science Foundation (No.2020M670236). The National Natural Science Foundation of China (No.81430094) substantial contributions to the conception or design of the work. China Postdoctoral Science Foundation (No.2020M670236) supports the analysis and interpretation of data for the work and the writing of this manuscript.
Author information
Affiliations
Contributions
Y.Z. and Y.Q. conceived and designed the experiments; Z.C., J.L. and N.H. collected the data; Z.C. contributed reagents/materials/analysis tools; Z.C. constructed the database and wrote this manuscript, Y.Z. and Y.Q. revised the manuscript. All authors read and approved the final manuscript.
Corresponding authors
Ethics declarations
Ethics approval and consent to participate
Not applicable.
Consent for publication
Not applicable.
Competing interests
The authors declare they have no competing interests.
Additional information
Publisher's Note
Springer Nature remains neutral with regard to jurisdictional claims in published maps and institutional affiliations.
Supplementary Information
Additional file 1: Figure S1
. Setting of protein sequence alignment options with Glycyrrhiza Uralensis protein database through the program of ‘blastp’. Figure S2. BLAST result of protein sequence alignment with Glycyrrhiza Uralensis protein database by inputting the query protein sequence. Figure S3. Setting of protein sequence alignment options with Glycyrrhiza Uralensis Nucleotide Database by the program of ‘tblastn’. Figure S4. BLAST result of protein sequence alignment with Glycyrrhiza Uralensis protein database by the program of ‘tblastn’. Figure S5. Setting of nucleotide sequence alignment options with Glycyrrhiza Uralensis Nucleotide Database through the program of ‘blastn’. Figure S6. BLAST result of nucleotide sequence alignment with Glycyrrhiza Uralensis nucleotide Database via the program of ‘blastn’. Figure S7. Setting of nucleotide sequence alignment options with Glycyrrhiza Uralensis Protein (Gancao) Database through the program of ‘blastx’. Figure S8. BLAST result of nucleotide sequence alignment with Glycyrrhiza Uralensis Protein (Gancao) Database via the program of ‘blastx’
Rights and permissions
Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
About this article
Cite this article
Chen, Z., Li, J., Hou, N. et al. TCM-Blast for traditional Chinese medicine genome alignment with integrated resources. BMC Plant Biol 21, 339 (2021). https://doi.org/10.1186/s12870-021-03096-1
Received:
Accepted:
Published:



