You are viewing the site in preview mode

Skip to main content

TCM-Blast for traditional Chinese medicine genome alignment with integrated resources

Abstract

The traditional Chinese medicine (TCM) genome project aims to reveal the genetic information and regulatory network of herbal medicines, and to clarify their molecular mechanisms in the prevention and treatment of human diseases. Moreover, the TCM genome could provide the basis for the discovery of the functional genes of active ingredients in TCM, and for the breeding and improvement of TCM. The traditional Chinese Medicine Basic Local Alignment Search Tool (TCM-Blast) is a web interface for TCM protein and DNA sequence similarity searches. It contains approximately 40G of genome data on TCMs, including protein and DNA sequence for 36 TCMs with high medical value.The development of a publicly accessible TCM genome alignment database hosted on the TCM-Blast website (http://viroblast.pungentdb.org.cn/TCM-Blast/viroblast.php) has expanded to query multiple sequence databases to obtain TCM genome data, and provide user-friendly output for easy analysis and browsing of BLAST results. The genome sequencing of TCMs helps to elucidate the biosynthetic pathways of important secondary metabolites and provides an essential resource for gene discovery studies and molecular breeding. The TCMs genome provides a valuable resource for the investigation of novel bioactive compounds and drugs from these TCMs under the guidance of TCM clinical practice. Our database could be expanded to other TCMs after the determination of their genome data.

Background

Whole-genome sequencing of the plants that form the basis of traditional Chinese medicine (TCM) is an important means for gene discovery and cultivation, synthetic biology, drug discovery and molecular breeding involving TCMs [1,2,3,4]. The genomic sequence provides a valuable resource not only for fundamental and applied research, but also for evolutionary and comparative genomics analyses, particularly in TCMs [5,6,7,8,9].

Experimental and clinical studies have demonstrated that TCMs have a wide range of pharmacological properties such as anti-inflammatory, antiviral, antimicrobial, antioxidative, antifungal, antithrombotic, antihyperlipidemic, analgesic, antidiabetic, antidepressant, antiasthma and anticancer activities as well as immunomodulatory, antidiabetic, gastroprotective, hepatoprotective, neuroprotective and cardioprotective effects [10,11,12,13,14,15,16,17,18]. Genome sequencing and its annotations provide an essential resource for TCM improvement through molecular breeding [19,20,21] and for the discovery of useful genes for engineering bioactive compounds through synthetic biology approaches [1, 22,23,24]. The availability of these genomic resources will facilitate the discovery of medicinally and nutritionally important genes, the genetic improvement of TCMs [7, 21, 25] and the identification of novel drug candidates [26].

The Herbal Medicine Omics Database (http://herbalplant.ynau.edu.cn/html/Genomes/) has collected only 23 published genomes of medicinal herbs and there has been no continued update of the increased data since 2019. Only 14 kinds of medicinal plant genome data were provided in the Medicinal Plant Genomics Resource (http://medicinalplantgenomics.msu.edu). BLAST against plant genomes data (https://blast.ncbi.nlm.nih.gov/Blast.cgi?PROGRAM=blastn&_TYPE=BlastSearch&BLAST_SPEC=Plants_MV&LINK_LOC=blasttab&LAST_PAGE=blastp) included few types of medicinal plants, and the genome comparison of the most common edible plants was provided).

Construction and content

Genome data of TCMs were originated from the Herbal Medicine Omics Database (http://herbalplant.ynau.edu.cn/html/Genomes/), the Medicinal Plant Genomics Resource (http://medicinalplantgenomics.msu.edu), and the BIG Data Center in Beijing Institute of Genomics, Chinese Academy of Sciences (http://bigd.big.ac.cn/gsa/statistics).

The genome data of Chinese medicinal materials originating from unlabeled references are from http://medicinalplantgenomics.msu.edu/, http://bigd.big.ac.cn/gsa/statistics.

The deployment strategy for TCM-Blast involves instantiating a provided Viroblast [27] that bundles the core components for TCM genome alignment. A user-friendly web interface to search the database has been implemented in PHP 7.0.32 (http://www.php.net) and deployed on an Apache 2.4.18 web server (http://www.apache.org/) and MySQL database server (https://www.mysql.com/) with Ubuntu 16.04 server (http://mirrors.aliyun.com/ubuntu-releases/16.04/). TCM-Blast had 36 TCMs genome datasets.

The information regarding TCM genome datasets is summarized in an online at the TCM-Blast website. The TCM genome data used in TCM-Blast were collected from the Herbal Medicine Omics Database (http://herbalplant.ynau.edu.cn/html/Genomes/), the Medicinal Plant Genomics Resource (http://medicinalplantgenomics.msu.edu), and the BIG Data Center in Beijing Institute of Genomics (http://bigd.big.ac.cn/gsa/statistics) (the further details on the genome data sources for the thirty-six TCMs, see Table 1). These data resources have been published in professional journals and plant gene databases by academic institutions or government departments merged with plant gene databases, with abundant data sources and reliable data quality. In addition to other data resources, this database in our study has the following advantages: 1) this database is currently the largest Chinese medicine genome database; 2) this database includes the plant genetic data of Chinese medicine sources; and 3) this database provides support for the TCM breeding, cultivation of TCMs and the discovery of active ingredients in TCMs.

Table 1 Data sources of thirty-six TCM genomes

Utility and discussion

Overview of TCM-Blast

We have developed TCM-Blast, a web-based database for TCM genome alignment (Fig. 1). TCM-Blast offers an interface to choose from TCM genome databases including TCM protein and DNA sequence datasets, which provide query functions with BLAST implementation [40]. TCM-Blast currently contains approximately 40 GB of TCM genome data, including the proteins and DNA sequences of 36 TCMs.

Fig. 1
figure1

The homepage of TCM-Blast

The mains functions of TCM-Blast

The user can directly enter the query sequence directly by pasting into the query box or by uploading the sequence as a FASTA file from a local file. TCM-Blast provides multiple TCM sequence databases. Users can then select specific TCM genome databases to run different programs (blastn, blastp, blastx, tblastn, tblastx). TCM-Blast consists of five general BLAST form types [27, 41,42,43] for TCM genome data:

  • blastn: search TCM nucleotide databases using a nucleotide query.

  • blastp: search TCM protein databases using a protein query.

  • blastx: search TCM protein databases using a translated nucleotide query

  • tblastn: search TCM translated nucleotide databases using a protein query.

  • tblastx: search TCM translated nucleotide databases using a translated nucleotide query

TCM-Blast provides an optional search function for advanced users who need to collect more specific information (Fig. 2) with the ability to set different parameters, such as the expected threshold, word size, max target sequences, etc., to glean more specific information for users. The TCM-Blast sequence alignment results of the TCM genome sequence are displayed in the summary table, which contains the query sequence name, subject sequence name, subject source database, position score, identity percentage, and E value (Fig. 3).

Fig. 2
figure2

The setting for favorite parameters in TCM-Blast

Fig. 3
figure3

The BLAST result of TCM protein and DNA sequence similarity in TCM-Blast

A case study of this database

For example, the user can select the Salvia Miltiorrhiza protein database with the programs blastp and obtain their expected BLAST results by inputting the protein sequence. In Fig. 4, the user has input the protein sequence fragment:

Fig. 4
figure4

The BLAST result of Salvia Miltiorrhiza protein alignment with the input of Salvia Miltiorrhiza protein sequence fragment into TCM-Blast. In the first section (a), the user checks their protein sequence. In the second section (b), the BLAST results with the input protein sequence are briefly displayed in the table. Furthermore, detailed score information on this alignment can be checked by clicking each score item button

MEKKQEDEKKTKLQGLPVDTSPYTQYKDLDDYKKQAYGTEGHLQPNPGRGAAASTDAPTTTAADDPNKQLSSTDAINRQGVP” in the “Enter query sequences” box; selected the Salvia Miltiorrhiza protein database; and obtained the BLAST result by clicking the “Basic Search” button. The top score of this search was “evm.model.C153610.1” subject, indicating that the input sequence fragment has high similarity to the Salvia Miltiorrhiza protein. For more detailed use cases for this database, please refer to the Supplementary file.

In the future, we will collect more Chinese medicine genome data to provide data support for Chinese medicine research.

Conclusions

Here, we reported a database of TCM-Blast database that integrates several database resources and markedly improves the efficiency of TCM genomic research. This database will allow users to perform batch sequence searches against integrated TCM genomic sequence databases. Therefore, TCM-Blast provided comprehensive Chinese medicine genome resource data on TCM scientific research and eliminates the latent redundancy occurring in other platforms.

Availability of data and materials

TCM-Blast is a free database and visualization tool open to all users with no login requirements and can be accessed at the following URL: http://viroblast.pungentdb.org.cn/TCM-Blast/viroblast.php. The web tool is functional on all modern web browsing environments including Google Chrome, Mozilla Firefox and Safari. All related species genomes data can be downloaded from http://viroblast.pungentdb.org.cn/TCM-Blast/db.

Abbreviations

TCM:

Traditional Chinese medicine

DNA:

Deoxyribonucleic acid

TCM-Blast:

Traditional Chinese medicine Basic Local Alignment Search Tool

References

  1. 1.

    Mochida K, Sakurai T, Seki H, Yoshida T, Takahagi K, Sawai S, et al. Draft genome assembly and annotation of Glycyrrhiza uralensis, a medicinal legume. Plant J. 2017;89(2):181–94. https://doi.org/10.1111/tpj.13385.

    Article  PubMed  Google Scholar 

  2. 2.

    Rehman F, Gong H, Li Z, Zeng S, Yang T, Ai P, et al. Identification of fruit size associated quantitative trait loci featuring SLAF based high-density linkage map of goji berry (Lycium spp.). BMC Plant Biol. 2020;20(1):1–18. https://doi.org/10.1186/s12870-020-02567-1.

    Article  Google Scholar 

  3. 3.

    Chen X, Li J, Wang X, Zhong L, Tang Y, Zhou X, et al. Full-length transcriptome sequencing and methyl jasmonate-induced expression profile analysis of genes related to patchoulol biosynthesis and regulation in Pogostemon cablin. BMC Plant Biol. 2019;19(1):1–18. https://doi.org/10.1186/s12870-019-1884-x.

    Article  Google Scholar 

  4. 4.

    Chen S, Song J, Sun C, Xu J, Zhu Y, Verpoorte R, et al. Herbal genomics: examining the biology of traditional medicines. Science. 2015; 347(6219):S27-S29. https://doi.org/10.17660/ActaHortic.2015.1089.62

    Article  Google Scholar 

  5. 5.

    Guan R, Zhao Y, Zhang H, Fan G, Liu X, Zhou W, et al. Draft genome of the living fossil Ginkgo biloba. Gigascience. 2016;5(1):s13742-016-0154–1. https://doi.org/10.1186/s13742-016-0154-1.

    Article  Google Scholar 

  6. 6.

    Sun H, Wu S, Zhang G, Jiao C, Guo S, Ren Y, et al. Karyotype stability and unbiased fractionation in the paleo-allotetraploid Cucurbita genomes. Mol Plant. 2017;10(10):1293–306. https://doi.org/10.1186/s13742-016-0154-1.

    Article  PubMed  Google Scholar 

  7. 7.

    Wu P, Zhou C, Cheng S, Wu Z, Lu W, Han J, et al. Integrated genome sequence and linkage map of physic nut (Jatropha curcas L.), a biodiesel plant. Plant J. 2015;81(5):810–21. https://doi.org/10.1111/tpj.12761.

    Article  PubMed  Google Scholar 

  8. 8.

    Yan L, Wang X, Liu H, Tian Y, Lian J, Yang R, et al. The genome of Dendrobium officinale illuminates the biology of the important traditional Chinese orchid herb. Mol Plant. 2015;8(6):922–34. https://doi.org/10.1016/j.molp.2014.12.011.

    Article  PubMed  Google Scholar 

  9. 9.

    Liu Y, Zeng S, Sun W, Wu M, Hu W, Shen X, et al. Comparative analysis of carotenoid accumulation in two goji (Lycium barbarum L. and L. ruthenicum Murr.) fruits. BMC Plant Biol. 2014;14(1):1–14. https://doi.org/10.1186/s12870-014-0269-4.

    Article  Google Scholar 

  10. 10.

    Chen Z, Cao Y, Zhang Y, Qiao Y. A novel discovery: holistic efficacy at the special organ level of pungent flavored compounds from pungent traditional Chinese medicine. Int J Mol Sci. 2019;20(3):752. https://doi.org/10.3390/ijms20030752.

    Article  PubMed Central  Google Scholar 

  11. 11.

    Cheung F. TCM: made in China. Nature. 2011;480(7378):S82–3. https://doi.org/10.1038/480S82a.

    Article  PubMed  Google Scholar 

  12. 12.

    Hosseinzadeh H, Nassiri-Asl M. Pharmacological effects of Glycyrrhiza spp. and its bioactive constituents: update and review. Phytother Res. 2015;29(12):1868–86. https://doi.org/10.1002/ptr.5487.

    Article  PubMed  Google Scholar 

  13. 13.

    Jiang W-Y. Therapeutic wisdom in traditional Chinese medicine: a perspective from modern science. Trends Pharmacol Sci. 2005;26(11):558–63. https://doi.org/10.1016/j.tips.2005.09.006.

    Article  PubMed  Google Scholar 

  14. 14.

    Qiu J. China plans to modernize traditional medicine. Nature. 2007;446:590–1. https://doi.org/10.1038/446590a.

    Article  PubMed  Google Scholar 

  15. 15.

    Science AAftAo. The art and science of traditional medicine part 1: TCM today—a case for integration. Science. 2014;346(6216):1569. https://doi.org/10.1126/science.346.6216.1569-d.

    Article  Google Scholar 

  16. 16.

    Xiong X. Integrating traditional Chinese medicine into Western cardiovascular medicine: an evidence-based approach. Nat Rev Cardiol. 2015;12(6):374–374. https://doi.org/10.1038/nrcardio.2014.177-c1.

    Article  PubMed  Google Scholar 

  17. 17.

    Tian P. Convergence: where west meets east. Nature. 2011;480(7378):S84–6. https://doi.org/10.1038/480S84a.

    Article  PubMed  Google Scholar 

  18. 18.

    Zhao J, Jiang P, Zhang W. Molecular networks for the study of TCM pharmacology. Brief Bioinform. 2010;11(4):417–30. https://doi.org/10.1093/bib/bbp063.

    Article  PubMed  Google Scholar 

  19. 19.

    Song C, Liu Y, Song A, Dong G, Zhao H, Sun W, et al. The Chrysanthemum nankingense genome provides insights into the evolution and diversification of chrysanthemum flowers and medicinal traits. Mol Plant. 2018;11(12):1482–91. https://doi.org/10.1016/j.molp.2018.10.003.

    Article  PubMed  Google Scholar 

  20. 20.

    da Silva JAT, Jin X, Dobránszki J, Lu J, Wang H, Zotz G, et al. Advances in Dendrobium molecular research: applications in genetic variation, identification and breeding. Mol Phylogenet Evol. 2016;95:196–216. https://doi.org/10.1016/j.ympev.2015.10.012.

    Article  Google Scholar 

  21. 21.

    Xu J, Chu Y, Liao B, Xiao S, Yin Q, Bai R, et al. Panax ginseng genome examination for ginsenoside biosynthesis. Gigascience. 2017;6(11):gix093. https://doi.org/10.1093/gigascience/gix093.

    Article  Google Scholar 

  22. 22.

    Vining KJ, Johnson SR, Ahkami A, Lange I, Parrish AN, Trapp SC, et al. Draft genome sequence of Mentha longifolia and development of resources for mint cultivar improvement. Mol Plant. 2017;10(2):323–39. https://doi.org/10.1016/j.molp.2016.10.018.

    Article  PubMed  Google Scholar 

  23. 23.

    Shen Q, Zhang L, Liao Z, Wang S, Yan T, Shi P, et al. The genome of Artemisia annua provides insight into the evolution of Asteraceae family and artemisinin biosynthesis. Mol Plant. 2018;11(6):776–88. https://doi.org/10.1016/j.molp.2018.03.015.

    Article  PubMed  Google Scholar 

  24. 24.

    Yang J, Zhang G, Zhang J, Liu H, Chen W, Wang X, et al. Hybrid de novo genome assembly of the Chinese herbal fleabane Erigeron breviscapus. Gigascience. 2017;6(6):gix028. https://doi.org/10.1093/gigascience/gix028.

    Article  Google Scholar 

  25. 25.

    Zhang L, Li X, Ma B, Gao Q, Du H, Han Y, et al. The tartary buckwheat genome provides insights into rutin biosynthesis and abiotic stress tolerance. Mol Plant. 2017;10(9):1224–37. https://doi.org/10.1016/j.molp.2017.08.013.

    Article  PubMed  Google Scholar 

  26. 26.

    Chen W, Kui L, Zhang G, Zhu S, Zhang J, Wang X, et al. Whole-genome sequencing and analysis of the Chinese herbal plant Panax notoginseng. Mol Plant. 2017;10(6):899–902. https://doi.org/10.1016/j.molp.2017.02.010.

    Article  PubMed  Google Scholar 

  27. 27.

    Deng W, Nickle DC, Learn GH, Maust B, Mullins JI. ViroBLAST: a stand-alone BLAST web server for flexible queries of multiple databases and user’s datasets. Bioinformatics. 2007;23(17):2334–6. https://doi.org/10.1093/bioinformatics/btm331.

    Article  PubMed  Google Scholar 

  28. 28.

    Wuyun T-N, Wang L, Liu H, Wang X, Zhang L, Bennetzen JL, et al. The hardy rubber tree genome provides insights into the evolution of polyisoprene biosynthesis. Mol Plant. 2018;11(3):429–42. https://doi.org/10.1016/j.molp.2017.11.014.

    Article  PubMed  Google Scholar 

  29. 29.

    Qin G, Xu C, Ming R, Tang H, Guyot R, Kramer EM, et al. The pomegranate (Punica granatum L.) genome and the genomics of punicalagin biosynthesis. Plant J. 2017;91(6):1108–28. https://doi.org/10.1111/tpj.13625.

    Article  PubMed  Google Scholar 

  30. 30.

    Tamiru M, Natsume S, Takagi H, White B, Yaegashi H, Shimizu M, et al. Genome sequencing of the staple food crop white Guinea yam enables the development of a molecular marker for sex determination. BMC Biol. 2017;15(1):1–20. https://doi.org/10.1186/s12915-017-0419-x.

    Article  Google Scholar 

  31. 31.

    Xiao L, Yang G, Zhang L, Yang X, Zhao S, Ji Z, et al. The resurrection genome of Boea hygrometrica: a blueprint for survival of dehydration. Proc Natl Acad Sci. 2015;112(18):5833–7. https://doi.org/10.1073/pnas.1505811112.

    Article  PubMed  PubMed Central  Google Scholar 

  32. 32.

    Tian Y, Zeng Y, Zhang J, Yang C, Yan L, Wang X, et al. High quality reference genome of drumstick tree (Moringa oleifera Lam.), a potential perennial crop. Sci China Life Sci. 2015;58(7):627–38. https://doi.org/10.1007/s11427-015-4872-x.

    Article  PubMed  Google Scholar 

  33. 33.

    Zhang G, Tian Y, Zhang J, Shu L, Yang S, Wang W, et al. Hybrid de novo genome assembly of the Chinese herbal plant danshen (Salvia miltiorrhiza Bunge). GigaScience. 2015;4(1):s13742-015-0104–3. https://doi.org/10.1186/s13742-015-0104-3.

    Article  Google Scholar 

  34. 34.

    Van Bakel H, Stout JM, Cote AG, Tallon CM, Sharpe AG, Hughes TR, et al. The draft genome and transcriptome of Cannabis sativa. Genome Biol. 2011;12(10):1–18. https://doi.org/10.1186/gb-2011-12-10-r102.

    Article  Google Scholar 

  35. 35.

    Liu X, Liu Y, Huang P, Ma Y, Qing Z, Tang Q, et al. The genome of medicinal plant Macleaya cordata provides new insights into benzylisoquinoline alkaloids metabolism. Mol Plant. 2017;10(7):975–89. https://doi.org/10.1016/j.molp.2017.05.007.

    Article  PubMed  Google Scholar 

  36. 36.

    Hoopes GM, Hamilton JP, Kim J, Zhao D, Wiegert-Rininger K, Crisovan E, et al. Genome assembly and annotation of the medicinal plant Calotropis gigantea, a producer of anticancer and antimalarial cardenolides. G3: Genes, Genomes, Genetics. 2018;8(2):385–91. https://doi.org/10.1534/g3.117.300331.

    Article  Google Scholar 

  37. 37.

    Fu Y, Li L, Hao S, Guan R, Fan G, Shi C, et al. Draft genome sequence of the Tibetan medicinal herb Rhodiola crenulata. Gigascience. 2017;6(6):gix033. https://doi.org/10.1093/gigascience/gix033.

    Article  Google Scholar 

  38. 38.

    Zhao D, Hamilton JP, Pham GM, Crisovan E, Wiegert-Rininger K, Vaillancourt B, et al. De novo genome assembly of Camptotheca acuminata, a natural source of the anti-cancer compound camptothecin. GigaScience. 2017;6(9):gix065. https://doi.org/10.1093/gigascience/gix065.

    Article  Google Scholar 

  39. 39.

    Kellner F, Kim J, Clavijo BJ, Hamilton JP, Childs KL, Vaillancourt B, et al. Genome-guided investigation of plant natural product biosynthesis. Plant J. 2015;82(4):680–92. https://doi.org/10.1111/tpj.12827.

    Article  PubMed  Google Scholar 

  40. 40.

    Zhang J, Tian Y, Yan L, Zhang G, Wang X, Zeng Y, et al. Genome of plant maca (Lepidium meyenii) illuminates genomic basis for high-altitude adaptation in the central Andes. Mol Plant. 2016;9(7):1066–77. https://doi.org/10.1016/j.molp.2016.04.016.

    Article  PubMed  Google Scholar 

  41. 41.

    Jones DT, Swindells MB. Getting the most from PSI–BLAST. Trends Biochem Sci. 2002;27(3):161–4. https://doi.org/10.1016/S0968-0004(01)02039-4.

    Article  PubMed  Google Scholar 

  42. 42.

    Schäffer AA, Aravind L, Madden TL, Shavirin S, Spouge JL, Wolf YI, et al. Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements. Nucleic Acids Res. 2001;29(14):2994–3005. https://doi.org/10.1093/nar/29.14.2994.

    Article  PubMed  PubMed Central  Google Scholar 

  43. 43.

    Johnson M, Zaretskaya I, Raytselis Y, Merezhuk Y, McGinnis S, Madden TL. NCBI BLAST: a better web interface. Nucleic Acids Res. 2008;36(suppl_2):W5-W9. https://doi.org/10.1093/nar/gkn201

    Article  PubMed  PubMed Central  Google Scholar 

Download references

Acknowledgements

We would like to thank Xingde Ren, Xiaosa Shi valuable suggestions. This work was supported by the National Natural Science Foundation of China (No.81430094) and China Postdoctoral Science Foundation (No.2020M670236).

Funding

Funding for open access charge: National Natural Science Foundation of China (No.81430094) and China Postdoctoral Science Foundation (No.2020M670236). The National Natural Science Foundation of China (No.81430094) substantial contributions to the conception or design of the work. China Postdoctoral Science Foundation (No.2020M670236) supports the analysis and interpretation of data for the work and the writing of this manuscript.

Author information

Affiliations

Authors

Contributions

Y.Z. and Y.Q. conceived and designed the experiments; Z.C., J.L. and N.H. collected the data; Z.C. contributed reagents/materials/analysis tools; Z.C. constructed the database and wrote this manuscript, Y.Z. and Y.Q. revised the manuscript. All authors read and approved the final manuscript.

Corresponding authors

Correspondence to Zhao Chen or Yanjiang Qiao.

Ethics declarations

Ethics approval and consent to participate

Not applicable.

Consent for publication

Not applicable.

Competing interests

The authors declare they have no competing interests.

Additional information

Publisher's Note

Springer Nature remains neutral with regard to jurisdictional claims in published maps and institutional affiliations.

Supplementary Information

Additional file 1: Figure S1

. Setting of protein sequence alignment options with Glycyrrhiza Uralensis protein database through the program of ‘blastp’. Figure S2. BLAST result of protein sequence alignment with Glycyrrhiza Uralensis protein database by inputting the query protein sequence. Figure S3. Setting of protein sequence alignment options with Glycyrrhiza Uralensis Nucleotide Database by the program of ‘tblastn’. Figure S4. BLAST result of protein sequence alignment with Glycyrrhiza Uralensis protein database by the program of ‘tblastn’. Figure S5. Setting of nucleotide sequence alignment options with Glycyrrhiza Uralensis Nucleotide Database through the program of ‘blastn’. Figure S6. BLAST result of nucleotide sequence alignment with Glycyrrhiza Uralensis nucleotide Database via the program of ‘blastn’. Figure S7. Setting of nucleotide sequence alignment options with Glycyrrhiza Uralensis Protein (Gancao) Database through the program of ‘blastx’. Figure S8. BLAST result of nucleotide sequence alignment with Glycyrrhiza Uralensis Protein (Gancao) Database via the program of ‘blastx’

Rights and permissions

Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data.

Reprints and Permissions

About this article

Verify currency and authenticity via CrossMark

Cite this article

Chen, Z., Li, J., Hou, N. et al. TCM-Blast for traditional Chinese medicine genome alignment with integrated resources. BMC Plant Biol 21, 339 (2021). https://doi.org/10.1186/s12870-021-03096-1

Download citation